PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02413.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 266aa    MW: 30287.5 Da    PI: 8.1821
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02413.1_g00004.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.44e-5171311128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lp+GfrFhPtdeelv++yL+++++++++++  vi+e+d+yk++Pw+Lp ++  +ekewyfFs+rd+ky++g+r+nra+ +gyWkat
  Rsa1.0_02413.1_g00004.1   7 LPAGFRFHPTDEELVKFYLCRRCASEPISV-PVIAEIDLYKFNPWELPDMALYGEKEWYFFSHRDRKYPNGSRPNRAAGTGYWKAT 91 
                              799***************************.89***************6666689******************************* PP

                      NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              g dk++ +   ++ g+kk Lvfy g+apkg+kt+W+mheyrl
  Rsa1.0_02413.1_g00004.1  92 GADKPIGK--PKKLGIKKALVFYAGKAPKGVKTNWIMHEYRL 131
                              ******98..6789**************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.55E-613159IPR003441NAC domain
PROSITE profilePS5100558.8287159IPR003441NAC domain
PfamPF023653.1E-268131IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001666Biological Processresponse to hypoxia
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009507Cellular Componentchloroplast
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MKAELNLPAG FRFHPTDEEL VKFYLCRRCA SEPISVPVIA EIDLYKFNPW ELPDMALYGE  60
KEWYFFSHRD RKYPNGSRPN RAAGTGYWKA TGADKPIGKP KKLGIKKALV FYAGKAPKGV  120
KTNWIMHEYR LANVDRSASS KKKNNLRLDD WVLCRIYNKK GTMEKYYPAD EKETAMMMTT  180
TTTTSDSKCS SHVISPDVTC SSEVQSESKW VDDLVEGVAF DASVFGSLLQ NDAFVPQFPY  240
HSDFAAMFED PPEQKPFLNW SFAPQG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-82216510174Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF9747660.0KF974766.1 Brassica napus NAC transcription factor 102-1 (NAC102-1.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013620870.10.0PREDICTED: NAC domain-containing protein 102-like
SwissprotQ8H1151e-161NA102_ARATH; NAC domain-containing protein 102
TrEMBLA0A0C4MXF10.0A0A0C4MXF1_BRANA; NAC102-1.1 protein
STRINGBra029201.1-P1e-173(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19028276
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63790.11e-147NAC domain containing protein 102